PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy009835
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 235aa    MW: 26596.1 Da    PI: 5.1743
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58467693PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS226.11.6e-6914219156364
       GRAS 156 eeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                  l  +g+rL+ +A++++vpfef++ v    ++++le+L+++++Ea+aVn++++lh+++desv++ ++rd++L+l k+lsPkvv++veqe ++n+++Fl 
  Ahy009835  14 GGLDIVGKRLSALAQSCNVPFEFHA-VRVPASEVQLEDLELRTNEAVAVNFAIMLHHVPDESVTSLNPRDRLLRLAKNLSPKVVTLVEQEFSTNNAQFLP 112
                568899*******************.7999********************************************************************** PP

       GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                rf+ +l+yy a+f+s++a lpre++eri+vE+++l+re+vn+vaceg+er+erhe l+kWr+r+++aGF p+pls+ +++++k+ll+ ++++ y++ee++
  Ahy009835 113 RFMVTLNYYLAVFESIDAVLPREHKERINVEQHCLAREVVNLVACEGEERVERHELLNKWRRRFTDAGFAPYPLSSLVNASIKTLLESYPGH-YTLEERD 211
                ******************************************************************************************77.*****99 PP

       GRAS 356 gslvlgWkd 364
                g+l l W d
  Ahy009835 212 GTL-LSWLD 219
                986.67765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.0961211IPR005202Transcription factor GRAS
PfamPF035145.7E-6714219IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
XAVDDSFSAY ARGGGLDIVG KRLSALAQSC NVPFEFHAVR VPASEVQLED LELRTNEAVA  60
VNFAIMLHHV PDESVTSLNP RDRLLRLAKN LSPKVVTLVE QEFSTNNAQF LPRFMVTLNY  120
YLAVFESIDA VLPREHKERI NVEQHCLARE VVNLVACEGE ERVERHELLN KWRRRFTDAG  180
FAPYPLSSLV NASIKTLLES YPGHYTLEER DGTLLSWLDE SGSYCLLCLE MKTLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2813205157347GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177902.11e-133PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 21
SwissprotQ8H1253e-99SCL5_ARATH; Scarecrow-like protein 5
TrEMBLA0A151S4X11e-128A0A151S4X1_CAJCA; Scarecrow-like protein 5
STRINGGLYMA08G43780.11e-127(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.11e-100scarecrow-like 5